Anti-TROY Rabbit Monoclonal Antibody [clone: ARC2393]
Catalog # ANTIA308442-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:AL023044
- Antigen symbol:TROY
- Clonality:Monoclonal
- Clone:ARC2393
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q9NS68
- Antigen synonyms:TAJ-alpha|TAJ alpha|TRADE|TNFRSF19|AW123854|TNFRSF19 tumor necrosis factor receptor superfamily, member 19|TNR19_HUMAN|Toxicity and JNK inducer|TAJ
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:46 kDa
- Sequence:RFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEK
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human TROY/TNFRSF19 (Q9NS68)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC2393] antibody to TROY for WB with samples derived from human, mouse and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:1,000
Type: Primary
Antigen: TROY
Clonality: Monoclonal
Clone: ARC2393
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat