Anti-STAT5 Rabbit Monoclonal Antibody [clone: ARC1215]
ANTIA306462-100
New Product
- Antibody type:Primary
- Antigen name:MGF
- Antigen symbol:STAT5
- Clonality:Monoclonal
- Clone:ARC1215
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P42229, P51692
- Antigen synonyms:STAT5B|Signal transducer and activator of transcription 5A|STAT5|Transcription factor STAT5A|STAT5A|Signal Transducer and Activator of Transcription 5B|STAT 5A|STAT 5B|STA5A_HUMAN
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:90 kDa
- Sequence:KQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLF
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 600-786 of human STAT5 (P42229).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC1215] antibody to STAT5 for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: STAT5
Clonality: Monoclonal
Clone: ARC1215
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat