Anti-KDM5A/Jarid1A/RBBP2 Rabbit Monoclonal Antibody [clone: ARC1120]
Catalog # ANTIA306168-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:Histone demethylase JARID1A
- Antigen symbol:KDM5A / Jarid1A / RBBP2
- Clonality:Monoclonal
- Clone:ARC1120
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoPrecipitation:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- ChIP:Yes
- Form:Liquid
- Gene ID:UniprotID# P29375
- Antigen synonyms:Jumonji/ARID domain containing protein 1A|Kdm5a|KDM5A_HUMAN|RBP2|KDM5A / Jarid1A / RBBP2|Jumonji/ARID domain-containing protein 1A|RBBP-2|Lysine-specific demethylase 5A|Retinoblastoma binding protein 2
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:200 kDa
- Sequence:HAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPGAKAQLEELMMVGDLLEVSLDETQHIWRILQATHPPSEDRFLHIMEDDSMEEKPLKVKGKDSSEKKRKRKLEKVEQLFGEGKQKSKELKKMDKPRKKKLKLGADKSKELNKLAKKLAKEEERKKKKEKAAAAKVELVKESTEKKREKKVLDIPSKYDWSGAEESDDENAVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCAKKQGPVSPGPAPPPSFIMSYKLPMEDLKETS
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1400-1690 of human KDM5A (P29375).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC1120] antibody to KDM5A/Jarid1A/RBBP2 for WB, IP and ChIP with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IP, ChIP
- Recommended Dilutions: WB: 1:500 to 1:2000, IP: 1:100 to 1:500, ChIP: 1:100 to 1:500
Type: Primary
Antigen: KDM5A / Jarid1A / RBBP2
Clonality: Monoclonal
Clone: ARC1120
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat