Specifications
- Antibody type:Primary
- Antigen name:intelectin 1 (galactofuranose binding)
- Antigen symbol:ITLN1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Form:Lyophilized
- Gene ID:55600
- Antigen synonyms:hIntL|HL-1|LFR|omentin|ITLN|INTL|HL1
- Storage temperature:At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
- Immunogen:A synthetic peptide corresponding to a sequence at the N-terminus of human ITLN1 (19-59aa TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR).
- Size:100 μg
- Pk:100 µG
Specifications
About this item
Intelectin-1, also known as omentin, is an intelectin encoded in humans by the ITLN1 gene. This gene is mapped to chromosome 1q21.3-q22 by genomic sequence analysis. It is expressed on multiple cell types and appears to participate in insulin signaling and microbe recognition. Intelectin-1 functions both as a receptor for bacterial arabinogalactans and for lactoferrin. Having conserved ligand binding site residues, both human and mouse intelectin-1 bind the exocyclic vicinal diol of carbohydrate ligands such as galactofuranose.
1. "Entrez Gene: ITLN1 intelectin 1 (galactofuranose binding)".
2. Lee JK, Schnee J, Pang M, Wolfert M, Baum LG, Moremen KW, Pierce M (Feb 2001). "Human homologs of the Xenopus oocyte cortical granule lectin XL35". Glycobiology 11 (1): 65–73.
3. Tsuji S, Uehori J, Matsumoto M, Suzuki Y, Matsuhisa A, Toyoshima K, Seya T (Jun 2001). "Human intelectin is a novel soluble lectin that recognizes galactofuranose in carbohydrate chains of bacterial cell wall". J Biol Chem 276 (26): 23456–63.
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.