Anti-RAB11FIP3 Rabbit Polyclonal Antibody
ABNOPAB22195
: Abnova
- Antibody type:Primary
- Antigen name:RAB11 Family interacting Protein 3
- Antigen symbol:RAB11FIP3
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Cross adsorption:No
- Format:Liquid
- Gene ID:9727
- Antigen synonyms:Rab11-FIP3|arfophilin-1|PAC196A12.1|eferin|rab11-family interacting protein 3|FIP3-Rab11|MU-MB-17.148|CART1|EF hands-containing Rab-interacting protein|cytoplasmic adaptor for RAR and TR|rab11 family-interacting protein 3
- Storage buffer:PBS, pH 7,5 (40% glycerol, 0,02% sodium azide)
- Sequence:PLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLSQTHPLPSEPVGSQ
- Storage temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human RAB11FIP3.
- Purification:Antigen affinity purification
- Size:100 μl
- Pk:100 µl
Rabbit polyclonal antibody raised against recombinant RAB11FIP3.
Recommended Dilutions: Immunohistochemistry: 1:20-1:50; Immunofluorescence: 1-4 ?g/ml
Type: Primary
Antigen: RAB11FIP3
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human