Anti-SLC6A9 Rabbit Polyclonal Antibody
Catalog # ABNOPAB20681
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:Solute Carrier Family 6 (Neurotransmitter Transporter), Member 9
- Antigen symbol:Solute carrier family 6, member 9
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Gene ID:6536
- Antigen synonyms:GlyT-1GlyT1|Glyt 1|SC6A9_HUMAN|Sodium- and chloride-dependent glycine transporter 1|glycine transporter 1|sodium and chloride dependent glycine transporter 1|Solute carrier family 6 member 9.|SLC6A9
- Storage buffer:PBS, pH 7,5 (40% glycerol, 0,02% sodium azide)
- Sequence:YCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGE
- Storage temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human SLC6A9.
- Purification:Antigen affinity purification
- Size:100 μl
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody raised against recombinant SLC6A9.
Recommended Dilutions: Immunohistochemistry: 1:50-1:200; Western Blot: 1:250-1:500
Type: Primary
Antigen: SLC6A9
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human