Anti-OSR1 Mouse Monoclonal Antibody [clone: 2B4]
Catalog # ABNOH00130497-M07A
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:Odd-skipped Related Transciption Factor 1
- Antigen symbol:OSR1
- Clonality:Monoclonal
- Clone:2B4
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgM kappa
- Reactivity:Human
- Cross adsorption:No
- Form:Liquid
- Gene ID:130497
- Antigen synonyms:Protein odd-skipped-related 1|ODD|OSR1
- Storage buffer:In ascites fluid
- Sequence:MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKP
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Shipping temperature:Ice
- Immunogen:OSR1 (NP_660303, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:200 µl
- Pk:200 µl
Specifications
About this item
Type: Primary
Antigen: OSR1
Clonality: Monoclonal
Clone: 2B4
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgM kappa
Reactivity: Human