Anti-PFKM Rabbit Monoclonal Antibody [clone: ARC0819]
ANTIA305930-100
New Product
- Antistofftype:Primary
- Antigen-navn:6 Phosphofructokinase Muscle Type
- Antigensymbol:PFKM
- Klonalitet:Monoclonal
- Klon:ARC0819
- Konjugering:Unconjugated
- Vert:Rabbit
- Isotype:IgG
- Reaktivitet:Human,Rat,Mouse
- Western blot:Yes
- Skjema:Liquid
- Gen-ID:UniprotID# P08237
- Antigen synonymer:GSD7|PFK, muscle type|6-phosphofructokinase|6-phosphofructokinase muscle type|Fructose 6 Phosphate Kinase|K6PF_HUMAN|EC 2.7.1.1|MGC8699|EC 2.7.1.11
- Lagringsbuffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molekylvekt:90 kDa
- Sekvens:FVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEA
- Lagringstemp:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Frakttemp.:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Fructose 6 Phosphate Kinase (P08237).
- Rensing:Affinity purification
- Pakketype:Plastic vial
- Fp:100 µl
Rabbit monoclonal [ARC0819] antibody to PFKM for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: PFKM
Clonality: Monoclonal
Clone: ARC0819
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat