Anti-GAD65 Rabbit Polyclonal Antibody
ANTIA12729-100
New Product
- Antibody type:Primary
- Antigen name:65 kDa glutamic acid decarboxylase
- Antigen symbol:GAD65
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q05329
- Antigen synonyms:GAD 65|GAD65|GAD-65|Gad2|DCE 2|GAD 2|GAD-2|DCE2|DCE2_HUMAN
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,01% Thiomersal
- Molecular weight:60 kDa
- Sequence:PLQCSALLVREEGLMQNCNQMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 401-585 of human GAD65/GAD2 (NP_001127838.1)
- Tested applications:ICC/IF
- Purification:Affinity purification.
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to GAD65 for WB and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: WB, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:1000, ICC/IF: 1:50 to 1:20
Type: Primary
Antigen: GAD65
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat