Anti-Desmin Rabbit Polyclonal Antibody
Catalog # ANTIA12692-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:CMD1I
- Antigen symbol:Desmin
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P17661
- Antigen synonyms:CSM1|FLJ41013|DESM_HUMAN|DES|Desmin|FLJ12025|FLJ39719|FLJ41793|CSM2
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,05% Proclin 300
- Molecular weight:55 kDa
- Sequence:DFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 90-470 of human Desmin (NP_001918.3)
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification.
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to Desmin for WB, IHC and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: WB, IHC, ICC/IF
- Recommended dilutions: WB: 1:100 to 1:500, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:20
Type: Primary
Antigen: Desmin
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat