Anti-CREBBP Rabbit Polyclonal Antibody
Catalog # ANTIA11437-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:CBP
- Antigen symbol:CREBBP
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q92793
- Antigen synonyms:KAT3A/|CREB binding protein|RTS|_HUMAN|RSTS|Crebbp|Cyclic AMP responsive enhancer binding protein|KAT3A|CREB-binding protein
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,05% Proclin 300
- Molecular weight:300 kDa
- Sequence:QASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGASSSVLAETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASK
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 200 - 300 of human CREBBP (NP_004371.2)
- Tested applications:IHC
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to CREBBP for WB and IHC with samples derived from human, mouse and rat.
- Validated applications: WB, IHC
- Recommended dilutions: WB: 1:500 to 1:1000, IHC: 1:50 to 1:200
Type: Primary
Antigen: CREBBP
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat