Anti-ANGPTL7 Mouse Monoclonal Antibody [clone: 3F1]
Catalog # ABNOH00010218-M05
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:Angiopoietin-like 7
- Antigen symbol:ANGPTL7
- Clonality:Monoclonal
- Clone:3F1
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- ImmunoFluorescence:Yes
- Isotype:IgG2b kappa
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Gene ID:10218
- Antigen synonyms:CDT6|AngX|dJ647M16.1
- Amino acid number:27 to 126
- Storage buffer:1x PBS, pH 7,4
- Sequence:QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSAD
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:ANGPTL7 (NP_066969, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 µg
- Pk:100 µg
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant ANGPTL7.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: ANGPTL7
Clonality: Monoclonal
Clone: 3F1
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b kappa
Reactivity: Human