10136 Results for: "3-Ethoxyacryloyl+chloride"
Anti-CLIC5 Mouse Monoclonal Antibody [clone: 16CT28.16.11]
Supplier: US Biological
Anti-CLIC5 Mouse Monoclonal Antibody [clone: 16CT28.16.11]
Expand 1 Items
Anti-SLC6A18 Rabbit Polyclonal Antibody
Supplier: Novus Biologicals
This antibody was developed against Recombinant Protein corresponding to amino acids: GFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVLMHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDL
Expand 1 Items
Anti-KCC1 Goat Polyclonal Antibody
Supplier: Abcam
Goat polyclonal to KCC1.
Expand 1 Items
Anti-CFTR Mouse Recombinant Antibody [clone: rCFTR/7175]
Supplier: Antibodies.com
Recombinant mouse monoclonal [rCFTR/7175] antibody to CFTR for IHC-P with samples derived from human.
Expand 1 Items
Anti-CFTR Mouse Recombinant Antibody [clone: rCFTR/8047]
Supplier: Antibodies.com
Recombinant mouse monoclonal [rCFTR/8047] antibody to CFTR for IHC-P with samples derived from human.
Expand 1 Items
Anti-SLC6A14 Rabbit Polyclonal Antibody
Supplier: Antibodies.com
Rabbit polyclonal antibody to SLC6A14 for WB with samples derived from Human and Mouse.
Expand 1 Items
Anti-CFTR Rabbit Recombinant Antibody [clone: CFTR/6477R]
Supplier: Antibodies.com
Recombinant rabbit monoclonal [CFTR/6477R] antibody to CFTR for IHC-P with samples derived from human.
Expand 1 Items
Anti-CFTR Rabbit Recombinant Antibody [Clone: CFTR/7003R]
Supplier: Antibodies.com
Recombinant rabbit monoclonal [CFTR/7003R] antibody to CFTR for IHC-P with samples derived from human.
Expand 1 Items
Anti-CFTR Rabbit Recombinant Antibody [clone: CFTR/7154R]
Supplier: Antibodies.com
Recombinant rabbit monoclonal [CFTR/7154R] antibody to CFTR for IHC-P with samples derived from human.
Expand 1 Items
Anti-CFTR Mouse Monoclonal Antibody [clone: CFTR/1341]
Supplier: Antibodies.com
Mouse monoclonal [CFTR/1341] antibody to CFTR for IHC-P with samples derived from human.
Expand 1 Items
Anti-ANO1 Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))
Supplier: US Biological
Anti-ANO1 Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))
Expand 1 Items
Anti-CLCN3 Mouse Monoclonal Antibody [clone: S258-5]
Supplier: US Biological
Anti-CLCN3 Mouse Monoclonal Antibody [clone: S258-5]
Expand 1 Items
Anti-CLCN7 Rabbit Polyclonal Antibody (AP (Alkaline Phosphatase))
Supplier: US Biological
Anti-CLCN7 Rabbit Polyclonal Antibody (AP (Alkaline Phosphatase))
Expand 1 Items
Indeno(1,2,3-cd)pyrene
Supplier: Restek
Organic Standard, Indeno(1,2,3-cd)pyrene, 1 ml/ampoule
Expand 1 Items
Anti-CFTR Mouse Monoclonal Antibody [clone: SPM176]
Supplier: Antibodies.com
Mouse monoclonal [SPM176] antibody to CFTR for IF, WB and IHC-P with samples derived from human and mouse.
Expand 1 Items
Anti-CFTR Rabbit Recombinant Antibody [clone: CFTR/1775R]
Supplier: Antibodies.com
Recombinant rabbit monoclonal [CFTR/1775R] antibody to CFTR for IHC-P with samples derived from human.
Expand 1 Items
Anti-CFTR Rabbit Polyclonal Antibody
Supplier: Antibodies.com
Rabbit polyclonal antibody to CFTR for WB, IHC and ELISA with samples derived from Human, Mouse and Rat.
Expand 1 Items
Anti-CFTR Mouse Monoclonal Antibody [clone: rCFTR/6476]
Supplier: Antibodies.com
Mouse monoclonal [rCFTR/6476] antibody to CFTR for IHC-P with samples derived from human.
Expand 1 Items
Anti-SLC12A6 Goat Polyclonal Antibody
Supplier: Everest Biotech
Anti-SLC12A6 Goat Polyclonal Antibody
Expand 1 Items
Anti-SLC12A1 Rabbit Polyclonal Antibody
Supplier: US Biological
Anti-SLC12A1 Rabbit Polyclonal Antibody
Expand 1 Items
Anti-CLIC1 Mouse Monoclonal Antibody [clone: 3F9]
Supplier: US Biological
Anti-CLIC1 Mouse Monoclonal Antibody [clone: 3F9]
Expand 1 Items
Anti-CLCN7 Rabbit Polyclonal Antibody (APC (Allophycocyanin))
Supplier: US Biological
Anti-CLCN7 Rabbit Polyclonal Antibody (APC (Allophycocyanin))
Expand 1 Items
Anti-SLC12A7 Rabbit Polyclonal Antibody
Supplier: US Biological
Anti-SLC12A7 Rabbit Polyclonal Antibody
Expand 1 Items
Anti-SLC12A7 Rabbit Polyclonal Antibody
Supplier: US Biological
Anti-SLC12A7 Rabbit Polyclonal Antibody
Expand 1 Items
Anti-CLIC5 Rabbit Polyclonal Antibody
Supplier: Aviva Systems Biology
Anti-CLIC5 Rabbit Polyclonal Antibody
Expand 3 Items
Anti-SLC12A2 Rabbit Polyclonal Antibody
Supplier: US Biological
Anti-SLC12A2 Rabbit Polyclonal Antibody
Expand 1 Items
Anti-CLIC4 Mouse Monoclonal Antibody
Supplier: Abgent
Anti-CLIC4 Mouse Monoclonal Antibody [clone: 17CT9.2.8]
Expand 1 Items
Anti-SLC12A3 Rabbit Polyclonal Antibody
Supplier: US Biological
Anti-SLC12A3 Rabbit Polyclonal Antibody
Expand 1 Items
Anti-CLIC6 Rabbit Polyclonal Antibody (APC (Allophycocyanin))
Supplier: US Biological
Anti-CLIC6 Rabbit Polyclonal Antibody (APC (Allophycocyanin))
Expand 1 Items
Anti-SLC12A5 Rabbit Polyclonal Antibody
Supplier: US Biological
Anti-SLC12A5 Rabbit Polyclonal Antibody
Expand 1 Items
Supplier: GRANT INSTRUMENTS
Supplier: BOCHEM
Supplier: VWR Collection
Supplier: OMEGA BIO-TEK
Supplier: DWK Life Sciences
Supplier: Thermo Fisher Scientific
Supplier: VWR Collection
Supplier: Oxford Nanopore Technologies
Supplier: Industrial Physics
Supplier: AAT Bioquest
Supplier: Integra
Supplier: Palbam
Supplier: VWR Collection
Supplier: Integra
Supplier: VWR Collection
Supplier: FACELLITATE
Supplier: NANOENTEK
Supplier: Greiner Bio-One