Anti-NMDAR2A Rabbit Monoclonal Antibody [clone: ARC0410]
Catalog # ANTIA308430-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:EPND
- Antigen symbol:NMDAR2A
- Clonality:Monoclonal
- Clone:ARC0410
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q12879
- Antigen synonyms:hNR2A|LKS|GRIN2A|GluN2A|GRIN 2A|Glutamate [NMDA] receptor subunit epsilon-1|FESD|Glutamate receptor|Glutamate receptor ionotropic N methyl D aspartate 2A
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:180 kDa
- Sequence:RELDLSRPSRSISLKDRERLLEGNFYGSLFSVPSSKLSGKKSSLFPQGLEDSKRSKSLLPDHTSDNPFLHSHRDDQRLVIGRCPSDPYKHSLPSQAVNDSY
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1300-1400 of human NMDAR2A (Q12879)
- Tested applications:IHC
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC0410] antibody to NMDAR2A for WB and IHC with samples derived from human, mouse and rat.
- Validated applications: WB, IHC
- Recommended dilutions: WB: 1:500 to 1:2,000, IHC: 1:50 to 1:200
Type: Primary
Antigen: NMDAR2A
Clonality: Monoclonal
Clone: ARC0410
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat