Anti-AMPK alpha 2 Rabbit Polyclonal Antibody
ANTIA308298-100
New Product
- Type antilichaam:Primair
- antigeen symbool:AMPK alpha 2
- Clonality:Polyklonaal
- Conjugatie:Onconjugeerd
- Host:Rabbit
- ImmunoChemie:Yes
- Isotype:IgG
- Reactivity:Human,Rat
- Western blot:Yes
- Formulier:Liquid
- Gen-ID:UniprotID# P54646
- Antigeen synoniemen:ACACA kinase|AMPKa2|AMPK alpha 2|AMPKalpha2|AMPK2|AMPK subunit alpha-2|Acetyl-CoA carboxylase kinase|AMPK alpha 2 chain|AAPK2_HUMAN
- Opslagbuffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol and 0,02% sodium azide
- Moleculair gewicht:62 kDa
- Sequentie:QDLPSYLFPEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLA
- Opslagtemperatuur:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogeen:Recombinant fusion protein containing a sequence corresponding to amino acids 270-343 of human PRKAA2 (NP_006243.2)
- Tested applications:ICC/IF
- Purification:Affinity purification
- Verpakking:Plastic vial
- VPE:100 µl
Rabbit polyclonal antibody to AMPK alpha 2 for WB and ICC/IF with samples derived from human and rat.
- Validated applications: WB, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:1,000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: AMPK alpha 2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Rat