Anti-NCR1 Rabbit Polyclonal Antibody
ANTIA9868-100
New Product
- Antibody type:Primary
- Antigen name:Activating NK receptor NK p46
- Antigen symbol:NCR1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# O76036
- Antigen synonyms:CD335|hNKp46|Natural cytotoxicity triggering receptor 1|Lymphocyte antigen 94 homolog|Lymphocyte antigen 94|Lymphocyte antigen 94 homolog (activating NK receptor|Ly94|NK p46)|FLJ99094
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,05% Proclin 300
- Molecular weight:34 kDa
- Sequence:SAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPDTWGTYLLTTETGLQKDHALWDHTAQNLLRM
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 20-258 of human NCR1 (NP_001138929.2)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to NCR1 for WB with samples derived from human.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:100
Type: Primary
Antigen: NCR1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human