Anti-Peroxiredoxin 4 Rabbit Monoclonal Antibody [clone: ARC1442]
Catalog # ANTIA307188-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:Antioxidant enzyme 372
- Antigen symbol:Peroxiredoxin 4
- Clonality:Monoclonal
- Clone:ARC1442
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q13162
- Antigen synonyms:Peroxiredoxin-4|Peroxiredoxin4|PRDX 4|Antioxidant enzyme AOE372|Peroxiredoxin IV|Peroxiredoxin 4|EC 1.11.1.15|AOE37 2|AOE37-2
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:27 kDa
- Sequence:MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKE
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Peroxiredoxin 4 (PRDX4) (PRDX4) (Q13162).
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC1442] antibody to Peroxiredoxin 4 for WB, IHC and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: Peroxiredoxin 4
Clonality: Monoclonal
Clone: ARC1442
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat