Anti-Synaptotagmin Rabbit Polyclonal Antibody
Catalog # ANTIA12750-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:HsT1192
- Antigen symbol:Synaptotagmin
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P21579
- Antigen synonyms:SVP65|Synaptotagmin II|P65|Synaptotagmin V|Synaptotagmin IV|synaptotagmin 4|Synaptotagmin|Synaptotagmin I|MYSPC
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,01% Thiomersal
- Molecular weight:60 kDa
- Sequence:LFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNN
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 84-157 of human SYT1 (NP_005630.1)
- Tested applications:ICC/IF
- Purification:Affinity purification.
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to Synaptotagmin for WB and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: WB, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:1000, ICC/IF: 1:50 to 1:20
Type: Primary
Antigen: Synaptotagmin
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat