Anti-Cytokeratin 19 Rabbit Polyclonal Antibody
Catalog # ANTIA12571-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:40 kDa keratin intermediate filament
- Antigen symbol:Cytokeratin 19
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P08727
- Antigen synonyms:Cytokeratin-19|CK19|CK-19|K1CS|Keratin type I 40kD|Cytokeratin 19|CK 19|Keratin type I 40 kD|K1C19_HUMAN
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,02% Sodium Azide
- Molecular weight:40 kDa
- Sequence:PGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 241-400 of human Cytokeratin 19 (Cytokeratin 19 (KRT19)) (NP_002267.2)
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification.
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to Cytokeratin 19 for WB, IHC and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: WB, IHC, ICC/IF
- Recommended dilutions: WB: 1:100 to 1:500, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:20
Type: Primary
Antigen: Cytokeratin 19
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat