Anti-ABCA1 Rabbit Polyclonal Antibody
Catalog # ANTIA12095-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:ABC 1
- Antigen symbol:ABCA1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Rat,Mouse
- Environmentally Preferable:
- Form:Liquid
- Gene ID:UniprotID# O95477
- Antigen synonyms:ATP binding Cassette 1|ABC-1|ABCA 1|ABCA1|ATP binding cassette sub family A member 1|ABCA1_HUMAN|ABC1|ATP binding cassette sub family A ABC1 member 1|ABC Transporter 1
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,01% Thiomersal
- Sequence:VQGIICNANNPCFRYPTPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKSEEMIQLGDQEVSELCGLPREKLAAAERVLRSNMDILKPILRTLNSTSPFPSKELAEATKTLLHSLGTLAQELFSMRSWSDMRQEVMFLTNVNSSSSSTQI
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 70 - 300 of human ABCA1 (NP_005493.2)
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to ABCA1 for ICC/IF with samples derived from mouse and rat.
- Validated applications: ICC/IF
- Recommended dilutions: ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: ABCA1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse, Rat