Anti-AMPK beta 1 Rabbit Monoclonal Antibody [Clone: ARC1061]
Catalog # ANTIA305692-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:1300015D22Rik
- Antigen symbol:AMPK beta 1
- Clonality:Monoclonal
- Clone:ARC1061
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q9Y478
- Antigen synonyms:AMPK beta 1 chain|AMPK|5'-AMP-activated protein kinase beta-1 subunit|AMP-activated, noncatalytic, beta-1|5''-AMP-activated protein kinase subunit beta-1|AAKB1_HUMAN|AMP-activated protein kinase beta subunit|AMPK beta 1|AMP-ACTIVATED PROTEIN KINASE, NONCATALYTIC, BETA-1
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:40 kDa
- Sequence:EEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVN
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 50 - 150 of human AMPKß1 (Q9Y478).
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC1061] antibody to AMPK beta 1 for WB, IHC and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: WB, IHC, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: AMPK beta 1
Clonality: Monoclonal
Clone: ARC1061
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat