Recombinant Collagen V (from E. coli)
NOVUNBP2-38162PEP
:
- Pk:0,1 mL
- Conjugation:Unconjugated
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Human
- Gene ID:COL5A1
- Amino acid number:PVEAAKETTEVPEELTPTPTEAAPMPETSEGAGKEEDVGIGDYDYVPSEDYYTPSPYDDLTYGEGEENPDQPTDPGAGAEIPTSTADTSNSSNPAPPPGEGADDLEGEFTEETIRNLDENYYDPYYDPTSSPSEIGPGMPANQDTIYE
- Protein synonyms:collagen alpha-1(V) chain|collagen, type V, alpha 1|alpha 1 type V collagen|EC 2.7.7.6|Collagen-5|EC 6.1.1
- Protein/peptide name:Collagen
- Purity:>80% by SDS-PAGE and Coomassie blue staining
- Formulation:PBS and 1M Urea, pH 7.4. No Preservative
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COL5A1.
Type V collagen is a minor component of the connective tissue, although it is present in many different types of connective tissue. Patients with defects in the type V collagen (Ehlers-Danlos syndrome) have weakened connective tissue characterized by hyperstrechable joints and fragile, easily bruisable skin.