Anti-FOS Mouse Monoclonal Antibody [clone: 2F3]
Catalog # ABNOH00002353-M59
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:FBJ Murine Osteosarcoma Viral Oncogene Homolog
- Antigen symbol:FOS
- Clonality:Monoclonal
- Clone:2F3
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- ImmunoFluorescence:Yes
- Isotype:IgG2a kappa
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Gene ID:2353
- Antigen synonyms:V-Fos FBJ Murine Osteosarcoma Viral Oncogene Homolog|AP-1|p55|C-FOS|G0/G1 Switch Regulatory Protein 7
- Amino acid number:1 to 100
- Storage buffer:1x PBS, pH 7,4
- Sequence:MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPA
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:FOS (NP_005243.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 µg
- Pk:100 µg
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant FOS.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: FOS
Clonality: Monoclonal
Clone: 2F3
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human