Anti-ATP2B4 Mouse Monoclonal Antibody [clone: 2C7]
Catalog # ABNOH00000493-M03A
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:ATPase, Ca++ transporting, plasma membrane 4
- Antigen symbol:ATP2B4
- Clonality:Monoclonal
- Clone:2C7
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG1 kappa
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Form:Ascites fluid
- Gene ID:493
- Antigen synonyms:MXRA1|PMCA4|PMCA4b|PMCA4x|ATP2B2
- Amino acid number:1 to 92
- Sequence:MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKT
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:ATP2B4 (NP_001675, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:200 μl
- Pk:200 µl
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant ATP2B4.
Type: Primary
Antigen: ATP2B4
Clonality: Monoclonal
Clone: 2C7
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 kappa
Reactivity: Human