Anti-GOT1L1 Rabbit Polyclonal Antibody
Catalog # ABNOPAB22216
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:Glutamic-oxaloacetic transaminase 1-like 1
- Antigen symbol:GOT1L1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Gene ID:137362
- Antigen synonyms:Glutamic oxaloacetic transaminase 1 like 1|GOT1L1|Glutamate oxaloacetate transaminase 1-like protein 1|Putative aspartate aminotransferase|Transaminase A-like protein 1.|cytoplasmic 2|AATC2_HUMAN
- Storage buffer:PBS, pH 7,5 (40% glycerol, 0,02% sodium azide)
- Sequence:YRVCMTNEGHPWVSLVVQKTRLQISQDPSLNYEYLPTMGLKSFIQASLALLFGKHSQAIVENRVGGVHTVGD
- Storage temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human GOT1L1.
- Purification:Antigen affinity purification
- Size:100 μl
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody raised against recombinant GOT1L1.
Recommended Dilutions: Immunohistochemistry: 1:20-1:50
Type: Primary
Antigen: GOT1L1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human