Anti-VPS37A Rabbit Polyclonal Antibody
ABNOPAB21960
: Abnova
- Antibody type:Primary
- Antigen name:Vacuolar Protein Sorting 37A
- Antigen symbol:VPS37A
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Cross adsorption:No
- Format:Liquid
- Gene ID:137492
- Antigen synonyms:HCRP1|PQBP2|SPG53
- Storage buffer:PBS, pH 7,5 (40% glycerol, 0,02% sodium azide)
- Sequence:QHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKMEIDDFLSSFMEKRTICHCRRAKEEKLQQAIAMHSQFHAPL
- Storage temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human VPS37A.
- Purification:Antigen affinity purification
- Size:100 μl
- Pk:100 µl
Rabbit polyclonal antibody raised against recombinant VPS37A.
Recommended Dilutions: Immunohistochemistry: 1:20-1:50; Immunofluorescence: 1-4 ?g/ml
Type: Primary
Antigen: VPS37A
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human