Anti-HIF-2-alpha Rabbit Polyclonal Antibody
Catalog # BSBTPA1129-1
Leverancier: Boster Bio
Specificaties
- Antibody type:Primary
- Antigen name:Hypoxia-inducible Factor 2-alpha
- Antigen symbol:HIF2A
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Rat
- Western blot:Yes
- Cross adsorption:No
- Form:Lyophilised
- Antigen synonyms:bHLHe73|ECYT4|HIF2A|HIF-1alpha-like factor|PAS domain-containing protein 2|hypoxia-inducible factor 2-alpha|endothelial PAS domain-containing protein 1|class E basic helix-loop-helix protein 73|EPAS-1|hypoxia-inducible factor 2 alpha|PASD2|member of PAS protein 25-|HLF|MOP2|basic-helix-loop-helix-PAS protein MOP2|HIF-1-alpha-like factor|HIF2-alpha|HIF-2-alpha
- Amino acid number:202 - 240
- Sequence:YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD
- Storage temperature:–20 °C
- Shipping temperature:Ice
- Immunogen:A synthetic peptide corresponding to a sequence at N-terminus of rat HIF-2-alpha (202-240aa YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD)
- Purification:purified by immunogen affinity purification
- Size:100 µg
- Pk:0,1 mg
Specificaties
Over dit artikel
Rabbit IgG polyclonal antibody for Endothelial PAS domain-containing protein 1 (EPAS1) detection. Tested with WB, IHC-P in Rat.
Reconstitute with distilled water.
Add 0,2 ml of distilled water will yield a concentration of 500 µg/ml.
Type: Primary
Antigen: HIF-2-alpha
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Rat