Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody type:Primary
- Antigen name:IFN-alpha-10
- Antigen symbol:Interferon alpha 10
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Rat
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P01566
- Antigen synonyms:Interferon alpha C|IFNA10|interferon, alpha 10|Interferon alpha-10|Interferon alpha-C|IFN10_HUMAN|Interferon alpha 6L|Interferon alpha-6L|Interferon alpha10
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,01% Thiomersal
- Molecular weight:25 kDa
- Sequence:CDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAW
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 24-100 of human IFNA10 (NP_002162.1)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to Interferon alpha 10 for WB with samples derived from Rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2,000
Type: Primary
Antigen: Interferon alpha 10
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Rat