Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody type:Primary
- Antigen name:All-trans-retinyl-palmitate hydrolase
- Antigen symbol:RPE65
- Clonality:Monoclonal
- Clone:ARC1659
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q16518
- Antigen synonyms:Retinal pigment epithelium specific 61 kDa protein|Leber congenital amaurosis|p63|LCA 2|mRPE 65|LCA2|rd12|mRPE65|rd 12
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:68 kDa
- Sequence:TIWLEPEVLFSGPRQAFEFPQINYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALEEDDGVVLSVVVSPGAGQKPA
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 400-500 of human RPE65 (Q16518).
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC1659] antibody to RPE65 for WB, IHC and ICC/IF with samples derived from mouse and rat.
- Validated applications: WB, IHC, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:2,000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: RPE65
Clonality: Monoclonal
Clone: ARC1659
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse;Rat