Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody type:Primary
- Antigen name:5'-AMP-activated protein kinase catalytic subunit alpha-2
- Antigen symbol:AMPK alpha 2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P54646
- Antigen synonyms:ACACA kinase|AMPKa2|AMPK alpha 2|AMPKalpha2|AMPK2|AMPK subunit alpha-2|Acetyl-CoA carboxylase kinase|AMPK alpha 2 chain|AAPK2_HUMAN
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol and 0,02% sodium azide
- Molecular weight:62 kDa
- Sequence:QDLPSYLFPEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLA
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 270-343 of human PRKAA2 (NP_006243.2)
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to AMPK alpha 2 for WB and ICC/IF with samples derived from human and rat.
- Validated applications: WB, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:1,000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: AMPK alpha 2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Rat