Anti-GOT2 Rabbit Polyclonal Antibody
Catalog # AVIVARP43518T10025
Supplier: Aviva Systems Biology
Specifications
- Antigen name:Glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)
- Antigen symbol:GOT2
- Clonality:Polyclonal
- Host:Rabbit
- ImmunoChemistry:Yes
- Reactivity:Zebrafish,Rabbit,Horse,Human,Bovine,Guinea pig,Dog,Rat,Mouse
- Western blot:Yes
- Format:Purified antibody supplied in 1X PBS buffer with 0,09% (w/v) sodium azide and 2% sucrose.
- Form:Liquid
- Gene ID:2806
- Antigen synonyms:KAT4|Glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)|mitAAT|KYAT4|DEE82|KATIV
- UniProtKB:P00505
- Molecular weight:45 kDa
- Sequence:AILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQI
- Storage temperature:For short term use, store at 2...8 ℃ up to 1 week. For long term storage, store at –20 ℃ in small aliquots to prevent freeze-thaw cycles.
- Concentration:1,0 mg/ml
- Immunogen:The immunogen is a synthetic peptide directed towards the C terminal region of human GOT2.
- Purification:Protein A purified.
- Size:430 AA
- Pk:25 µl
Specifications
About this item
Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.
Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.
Type:
Antigen: GOT2
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human