Interleukin-19 (IL-19) is a member of the interleukin 10 (IL-10) cytokine family and is produced by B cells and monocytes. IL-19 binds the interleukin 20 receptor complex (IL-20R) to activate STAT3 signaling. IL-19 induces interleukin 6 (IL-6) and tumor necrosis factor alpha (TNF-α) expression in monocytes, and promotes type 2 T helper (Th2) cell-mediated immune responses. IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.
- High quality
- Low endotoxin
- Affordable
IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.
Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Conjugation:Unconjugated
- Protein function:Cytokine
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Mouse
- Storage conditions:−20 °C
- Endotoxin content:Endotoxin LAL (EU/µg) ≤0.1
- Biological activity:Bioactivity: No biological activity data is available at this time
- Gene ID:Q8CJ70
- Reconstitution instructions:Sterile water at 0,1 mg/ml
- Endotoxin-free:N
- Carrier-free:Y
- Protease-free:N
- Animal-free:N
- Protein synonyms:IL19|IL-19|Interleukin 19
- UniProtKB:Q8CJ70
- Protein/peptide name:IL-19
- Purity:≥95%
- Molecular weight:17,7 kDa
- Sequence:MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
- Endotoxin level:Low
- Formulation:10 mM sodium phosphate, 50 mM sodium chloride, pH 7,5
- Nuclease-free:N
- Grade:RUO
- Shipping temperature:RT