Human recombinant VEGI 192 (from E. coli)
Supplier: Biorbyt
Certificates
About this item
Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Conjugation:Unconjugated
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Human
- Storage conditions:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Biological activity:ED50 is less than 5 ug/ml as determined by the dosedependent inhibition of the proliferation of HUVEC cells.
- Protein synonyms:Tumor Necrosis Factor Ligand Superfamily Member 15
- UniProtKB:O95150-2 (Human)
- Protein/peptide name:VEGI 192
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELG LAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYP EPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
- Formulation:Lyophilized from a 0.2 um filtered solution of 20mM PB, 250mM NaCl, pH 7.5.
- Tested applications:SDS-PAGE , FuncS
Specifications
Frequently Bought Together