Order Entry
Northern Ireland
ContactUsLinkComponent
Human recombinant PTH 184 (from E. coli)
Human recombinant PTH 184 (from E. coli)
Supplier:  Biorbyt
Certificates
Human recombinant PTH 184 (from E. coli)
Supplier:  Biorbyt

Some Products May Appear Restricted

To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.

If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)

 

If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation;  additional documentation will be requested for these items prior to shipment. 

Specifications

  • Conjugation:
    Unconjugated
  • Protein/peptide type:
    Recombinant
  • Source:
    E. coli
  • Species:
    Human
  • Storage conditions:
    Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
  • Biological activity:
    Recombinant PTH is fully biologically active when compared to standards.
    Specific Activity of 1.0 x 104 IU/mg as calculated by the UMR106 cell/cAMP method.
  • Protein synonyms:
    Parathyrin|PTH1 receptor|PTHY_protein.|PTH1|Parathyroid hormone 1|Parathormone|hPTH|PTHR1|PTHR|PTH|Parathyroid hormone|PTH1R
  • UniProtKB:
    P01270 (Human)
  • Protein/peptide name:
    PTH 184
  • Purity:
    >95% as determined by reducing SDS-PAGE.
  • Sequence:
    SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEK SLGEADKADVNVLTKAKSQ
  • Formulation:
    Lyophilized from a 0.2 um filtered solution of 10mM HAc-NaAc, 150mM NaCl, 5% Mannitol, pH 4.0.
  • Tested applications:
    SDS-PAGE , FuncS

Specifications

Related Information

Frequently Bought Together