Human recombinant Kallikrein 11 (from HEK293 cells)
Supplier: Biorbyt
Certificates
About this item
Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Conjugation:Unconjugated
- Protein/peptide type:Recombinant
- Source:HEK293 cells
- Species:Human
- Storage conditions:Store at −20 °C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
- Protein synonyms:Kallikrein11
- UniProtKB:Q9UBX7 (Human)
- Protein/peptide name:Kallikrein 11
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:ETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGC EQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWG STSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSL QGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNNVDHHHHHH
- Formulation:Supplied as a 0.2 um filtered solution of 20mM TrisHCl, 150mM NaCl, 2mM CaCl2, pH 8.0.
- Tested applications:SDS-PAGE
Specifications
Frequently Bought Together