Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Antibody type:Primary
- Antigen name:Protein-L-isoaspartate(D-aspartate) O-methyltransferase
- Antigen symbol:PCMT1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Gene ID:5110
- Antigen synonyms:PIMT|Protein L-isoaspartyl/D-aspartyl methyltransferase|Protein-L-isoaspartate(D-aspartate) O-methyltransferase|PCMT1|Protein-beta-aspartate methyltransferase|L-isoaspartyl protein carboxyl methyltransferase
- Storage buffer:PBS, pH 7,2 (40% glycerol, 0,02% sodium azide)
- Sequence:AKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWS
- Storage temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human PCMT1.
- Purification:Antigen affinity purification
- Size:100 μl
- Pk:100 µg
Rabbit polyclonal antibody raised against recombinant PCMT1.
Recommended Dilutions: Immunohistochemistry: 1:200-1:500; Immunofluorescence: 1-4 ?g/ml; Western Blot: 1:100-1:500
Type: Primary
Antigen: PCMT1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: