To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody type:Primary
- Antigen name:FBJ Murine Osteosarcoma Viral Oncogene Homolog
- Antigen symbol:FOS
- Clonality:Monoclonal
- Clone:2F3
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- ImmunoFluorescence:Yes
- Isotype:IgG2a kappa
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Gene ID:2353
- Antigen synonyms:V-Fos FBJ Murine Osteosarcoma Viral Oncogene Homolog|AP-1|p55|C-FOS|G0/G1 Switch Regulatory Protein 7
- Amino acid number:1 to 100
- Storage buffer:1x PBS, pH 7,4
- Sequence:MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPA
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:FOS (NP_005243.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 µg
- Pk:100 µg
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant FOS.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: FOS
Clonality: Monoclonal
Clone: 2F3
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human