Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Antibody type:Primary
- Antigen name:Histamine N-methyltransferase
- Antigen symbol:HNMT
- Clonality:Monoclonal
- Clone:2G12
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:Multiple
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Form:Ascites fluid
- Gene ID:3176
- Antigen synonyms:HNMT-S1|HMT|HNMT-S2
- Amino acid number:184 to 292
- Sequence:KKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:HNMT (NP_008826, 184 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:200 μl
- Pk:200 µl
Mouse monoclonal antibody raised against a partial recombinant HNMT.
Type: Primary
Antigen: HNMT
Clonality: Monoclonal
Clone: 2G12
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: Multiple
Reactivity: Human