To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody type:Primary
- Antigen name:ATPase, Ca++ transporting, plasma membrane 4
- Antigen symbol:ATP2B4
- Clonality:Monoclonal
- Clone:2C7
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG1 kappa
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Form:Ascites fluid
- Gene ID:493
- Antigen synonyms:MXRA1|PMCA4|PMCA4b|PMCA4x|ATP2B2
- Amino acid number:1 to 92
- Sequence:MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKT
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:ATP2B4 (NP_001675, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:200 μl
- Pk:200 µl
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant ATP2B4.
Type: Primary
Antigen: ATP2B4
Clonality: Monoclonal
Clone: 2C7
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 kappa
Reactivity: Human