Anti-Brain Natriuretic Peptide Mouse Monoclonal Antibody [clone: 17-16]
Supplier: US Biological
Certificates
About this item
Type: Primary
Antigen: Brain Natriuretic Peptide
Clonality: Monoclonal
Clone: 17-16
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG1
Reactivity: Human,
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.
To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Catalog No:
- USBIB2702-33E-10
- USBIB2702-33E-100
- Antigen symbol:
- BNP
- BNP
- Antigen name:
- Brain Natriuretic Peptide
- Brain Natriuretic Peptide
- Antibody type:
- Primary
- Primary
- Clonality:
- Monoclonal
- Monoclonal
- Conjugation:
- Unconjugated
- Unconjugated
- Clone:
- 17-16
- 17-16
- Reactivity:
- Human
- Human
- Host:
- Mouse
- Mouse
- Isotype:
- IgG1
- IgG1
- ELISA:
- Yes
- Yes
- Immunogen:
- Synthetic human BNP (aa 1-32) KLH conjugated (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH)
- Synthetic human BNP (aa 1-32) KLH conjugated (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH)
- Amino acid number:
- 1 to 32
- 1 to 32
- Sequence:
- SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
- Form:
- lyophilized powder
- lyophilized powder
- Purification:
- purified by Protein G chromatography
- purified by Protein G chromatography
- Concentration:
- ~1 mg/ml
- ~1 mg/ml
- Cross adsorption:
- No
- No
- Storage buffer:
- PBS, pH 7,2
- PBS, pH 7,2
- Storage temperature:
- –20 °C
- –20 °C
Specifications
Frequently Bought Together