Type: Primary
Antigen: Brain Natriuretic Peptide
Clonality: Monoclonal
Clone: 17-16
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG1
Reactivity: Human,
Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Catalog No:
- USBIB2702-33E-10
- USBIB2702-33E-100
- Antigen symbol:
- BNP
- BNP
- Antigen name:
- Brain Natriuretic Peptide
- Brain Natriuretic Peptide
- Antibody type:
- Primary
- Primary
- Clonality:
- Monoclonal
- Monoclonal
- Conjugation:
- Unconjugated
- Unconjugated
- Clone:
- 17-16
- 17-16
- Reactivity:
- Human
- Human
- Host:
- Mouse
- Mouse
- Isotype:
- IgG1
- IgG1
- ELISA:
- Yes
- Yes
- Immunogen:
- Synthetic human BNP (aa 1-32) KLH conjugated (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH)
- Synthetic human BNP (aa 1-32) KLH conjugated (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH)
- Amino acid number:
- 1 to 32
- 1 to 32
- Sequence:
- SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
- Form:
- lyophilized powder
- lyophilized powder
- Purification:
- purified by Protein G chromatography
- purified by Protein G chromatography
- Concentration:
- ~1 mg/ml
- ~1 mg/ml
- Cross adsorption:
- No
- No
- Storage buffer:
- PBS, pH 7,2
- PBS, pH 7,2
- Storage temperature:
- –20 °C
- –20 °C
: VWR Chemicals
: VWR Chemicals
: VWR Collection
: VWR Collection
: VWR Collection
: VWR Collection
: VWR Collection
: KIMBERLY CLARK