Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody type:Primary
- Antigen symbol:BD1
- Clonality:Monoclonal
- Clone:M4-14b-H4
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG1
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Form:lyophilized powder
- Amino acid number:1 to 36
- Storage buffer:50mM Tris, pH 7,4.
- Storage temperature:–20 °C
- Concentration:~1 mg/ml
- Immunogen:Synthetic human β-Defensin 1 (aa 1-36) (3 disulfide bridges) (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK)
- Purification:purified by Protein G chromatography
- Size:10 μg
- Pk:10 µG
Specifications
About this item
Recommended dilution: Western Blot: 1:1000-1:2000
Type: Primary
Antigen: BD1
Clonality: Monoclonal
Clone: M4-14b-H4
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG1
Reactivity: Human,