Anti-CLDN7 Rabbit Polyclonal Antibody
Catalog # ORIGTA329247
Supplier: OriGene
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.
To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody type:Primary
- Antigen symbol:CLDN7
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Environmentally Preferable:
- Cross adsorption:No
- Form:Liquid
- Storage buffer:Lyophilized powder. Add 50 ul of distilled water. Final anti-CLDN7 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
- Molecular weight:22 kDa
- Sequence:GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV
- Storage temperature:–20 °C
- Shipping temperature:–20 °C
- Immunogen:The immunogen for anti-CLDN7 antibody: synthetic peptide directed towards the C terminal of human CLDN7. Synthetic peptide located within the following region: GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV
- Size:50 μg
- Pk:50 µG
Specifications
About this item
Type: Primary
Antigen: CLDN7
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human