Order Entry
Northern Ireland
ContactUsLinkComponent
 
Anti-TH Rabbit Polyclonal Antibody
  BSBTPB9449
undefined
Anti-TH Rabbit Polyclonal Antibody
  BSBTPB9449

Some Products May Appear Restricted

To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.

If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)

 

If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation;  additional documentation will be requested for these items prior to shipment. 

 

  • Antibody type:
    Primary
  • Antigen name:
    Tyrosine Hydroxylase
  • Antigen symbol:
    TH
  • Clonality:
    Polyclonal
  • Host:
    Rabbit
  • ImmunoChemistry:
    Yes
  • Isotype:
    IgG
  • Reactivity:
    Rat,
    Mouse
  • Western blot:
    Yes
  • Form:
    Lyophilized
  • Gene ID:
    7054
  • Antigen synonyms:
    DYT5b|TYH|DYT14
  • UniProtKB:
    P07101
  • Storage temperature:
    At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
  • Immunogen:
    A synthetic peptide corresponding to a sequence in the middle region of human TH (193-222aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH), identical to the related mouse and rat sequences.
  • Purification:
    Immunogen affinity purified.
  • Size:
    100 µg/vial
  • Pk:
    100 µG

 

 

Rabbit IgG polyclonal antibody for Tyrosine 3-monooxygenase(TH) detection. Tested with WB, IHC-P in Mouse;Rat.

TH is equal to tyrosine hydroxylase. The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. In humans, tyrosine hydroxylase is encoded by the TH gene, and the enzyme is present in the central nervous system (CNS), peripheral sympathetic neurons and the adrenal medulla. Tyrosine hydroxylase, phenylalanine hydroxylase and tryptophan hydroxylase together make up the family of aromatic amino acid hydroxylases (AAAHs).

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

WB: The detection limit for TH is approximately 0.1ng/lane under reducing conditions.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.

Type: Primary
Antigen: THBS1
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human