Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody type:Primary
- Antigen name:signal transducer and activator of transcription 6, interleukin-4 induced
- Antigen symbol:STAT6
- Clonality:Polyclonal
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat
- Western blot:Yes
- Form:Lyophilized
- Gene ID:6778
- Antigen synonyms:STAT6C|IL-4-STAT|D12S1644|STAT6B
- UniProtKB:P42226
- Storage temperature:At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
- Immunogen:A synthetic peptide corresponding to a sequence at the N-terminus of human STAT6(85-115aa ESIYQRDPLKLVATFRQILQGEKKAVMEQFR), different from the related mouse sequence by three amino acids.
- Purification:Immunogen affinity purified.
- Size:100 µg/vial
- Pk:100 µG
Specifications
About this item
Rabbit IgG polyclonal antibody for Signal transducer and activator of transcription 6(STAT6) detection. Tested with WB in Human;Rat.
STAT6 is a human gene. The protein encoded by this gene is a member of the STAT family of transcription factors. The gene spans 19 kb and contains 23 exons. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2), expression of cell surface markers, and class switch of immunoglobulins.
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
WB: The detection limit for STAT6 is approximately 0.1ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Type: Primary
Antigen: STIM1
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat