Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody type:Primary
- Antigen name:Brain Natriuretic Peptide 32
- Antigen symbol:BNP32
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human,Rat
- Format:Serum
- Form:lyophilized powder
- Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
- Storage temperature:Cool
- Shipping temperature:Ice
- Size:50 µl
- Pk:50 µl
Specifications
About this item
Recommended dilution: Immunofluorescence: 1:200; Immunochemistry: 1:500
Type: Primary
Antigen: Brain Natriuretic Peptide 32
Clonality: polyclonal
Clone:
Conjugation: unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Rat