Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Antibody type:Primary
- Antigen name:Ubiquitously-expressed Transcript
- Antigen symbol:UXT
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Mouse
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Form:liquid
- Amino acid number:1 to 169
- Storage buffer:PBS, pH 7,2.
- Sequence:MVFPLPTPQEPIMATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH
- Storage temperature:Cool
- Shipping temperature:Ice
- Purification:purified by Protein A chromatography
- Size:50 µg
- Pk:50 µG
Recommended dilution: Immunofluorescence: 10 ?g/ml
Type: Primary
Antigen: UXT (ubiquitously-expressed, prefoldin-like chaperone)
Clonality: polyclonal
Clone:
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG
Reactivity: Human