Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody type:Primary
- Antigen name:enolase 2 (gamma, neuronal)
- Antigen symbol:ENO2
- Clonality:Monoclonal
- Clone:1A3
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western blot:Yes
- Form:liquid
- Storage buffer:PBS, pH 7,2.
- Sequence:PKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNPSVL
- Storage temperature:Cool
- Shipping temperature:Ice
- Purification:purified by Protein A chromatography
- Size:100 µg
- Pk:100 µG
Specifications
About this item
Type: Primary
Antigen: ENO2 (enolase 2 (gamma, neuronal))
Clonality: monoclonal
Clone: 1A3
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human