Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody type:Primary
- Antigen name:Ariadne RBR E3 ubiquitin protein ligase 2
- Antigen symbol:ARIH2
- Clonality:Monoclonal
- Clone:1C3
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgM kappa
- Reactivity:Human
- Western blot:Yes
- Format:ascites
- Form:liquid
- Amino acid number:331 to 420
- Storage buffer:ascites fluid.
- Sequence:KTHGSEYYECSRYKENPDIVNQSQQAQAREALKKYLFYFERWENHNKSLQLEAQTYQRIHEKIQERVMNNLGTWIDWQYLQNAAKLLAKC
- Storage temperature:Cool
- Shipping temperature:Ice
- Size:200 µl
- Pk:200 µl
Specifications
About this item
Type: Primary
Antigen: ARIH2 (ariadne RBR E3 ubiquitin protein ligase 2)
Clonality: monoclonal
Clone: 1C3
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgM Kappa
Reactivity: Human