Mouse Recombinant IL-19 (Animal free) (from E. coli)
Nome del fornitore: Shenandoah Biotechnology
Certificati
Informazioni su questo articolo
Macrophage Inflammatory Protein 2 (MIP-2), also known as CXCL2, is a small cytokine that is secreted by monocytes and neutrophils at sites of inflammation. MIP-2 functions through the chemokine receptor CXCR2 to act as a chemotactic agent for leukocytes and hematopoietic cells.
- High quality
- Low endotoxin
- Affordable
IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.
Certifications: Animal-Free (AF) proteins are identical to regular proteins and offer additional documentation showing that they were produced with no materials of animal or human origin using ANIMAL-FREE purification processes.
Caution: For research use only.
Specifiche
- Coniugazione:Non coniugato
- Protein function:Cytokine
- Protein/peptide type:Recombinant
- Sorgente luminosa:E. coli
- Specie:Mouse
- Condizioni di conservazione:−20 °C
- Contenuto di endotossine:Endotoxin LAL (EU/µg) ≤0.1
- Attività biologica:Bioactivity: No biological activity data is available at this time
- ID gene:Q8CJ70
- Ricostituzione:Sterile water at 0,1 mg/ml
- Privo di endotossine:N
- Senza corriere:Y
- Protease-free:N
- Senza animali:Y
- Protein synonyms:IL19|IL-19|Interleukin 19
- UniProtKB:Q8CJ70
- Protein/peptide name:IL-19
- Purezza:≥95%
- Peso molecolare:17,7 kDa
- Sequenza:MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
- Livello di endotossine:Low
- Formulazione:10 mM sodium phosphate, 50 mM sodium chloride, pH 7,5
- Esente da nucleasi:N
- Grado:RUO
- Temperatura di spedizione:RT
Specifiche
Frequently Bought Together