Specifiche

• Coniugazione:
  Non coniugato
• Protein/peptide type:
  Recombinant
• Sorgente luminosa:
  E. coli
• Specie:
  Human
• Condizioni di conservazione:
  Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
• Attività biologica:
  ED50 is less than 2 ng/ml as calculated by the dosedependent proliferation of murine BALB/c 3T3 cells.
• Protein synonyms:
  ProEpidermal Growth Factor
• UniProtKB:
  P01133 (Human)
• Protein/peptide name:
  EGF
• Purezza:
  >95% as determined by reducing SDS-PAGE.
• Sequenza:
  NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
• Formulazione:
  Lyophilized from a 0.2 um filtered solution of 20mM PB, 200mM NaCl, pH 7.0.
• Applicazioni testate:
  SDS-PAGE , FuncS